SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000060560 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000060560
Domain Number 1 Region: 24-118
Classification Level Classification E-value
Superfamily Immunoglobulin 4.04e-24
Family V set domains (antibody variable domain-like) 0.0000184
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000060560
Sequence length 132
Comment (Rattus norvegicus)
Sequence
MNMLPDTCSVLVLLLILRRSNGDSVTQTEGLVTLTEGSLVVLNCTYQTTYSVSTLFWYVQ
YLNEAPRLLLRSSTDNKRTEHEGFHATLHKSSRSFRLQKPSAQLSDSALYYCAVETQNKV
LSLDGGTLTANI
Download sequence
Identical sequences D3ZN87
10116.ENSRNOP00000060560 ENSRNOP00000060560 ENSRNOP00000060560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]