SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000060821 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000060821
Domain Number 1 Region: 1135-1304
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.37e-47
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.0089
Further Details:      
 
Domain Number 2 Region: 988-1132
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 3.08e-39
Family Poly(A) polymerase, PAP, N-terminal domain 0.017
Further Details:      
 
Domain Number 3 Region: 431-492,537-630
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.07e-36
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.052
Further Details:      
 
Domain Number 4 Region: 276-464
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 9.35e-26
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.056
Further Details:      
 
Domain Number 5 Region: 1428-1464
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000117
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 
Domain Number 6 Region: 1328-1357
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000907
Family Retrovirus zinc finger-like domains 0.0052
Further Details:      
 
Domain Number 7 Region: 952-976
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000436
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000060821
Domain Number - Region: 238-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0014
Family HkH motif-containing C2H2 finger 0.098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000060821
Sequence length 1485
Comment (Rattus norvegicus)
Sequence
MGDTAKPYFVKRTKDRGIIDDDDFRRGHPQQDYLMMDDYAKGHSSKMEKGLPKKKMSPGN
YGNTPRKGLYAVSSNPYAFKNPMYSQPAWMNDNHKDQNKKWLSDELAGNADSWREFKPGP
RIPVLSRSRKESFQESEDTYRWPEGRGCRAVRRLFQKDLASLEAMTEVEAGSPENKKQRS
RPRKPRRTRTEDIEQDGELEGPVIDESVLSTKELLGLQQAEERLKRDCIERLKRRSRNCP
TAKYTCKLCDALIDSIPFAHKHIKEKRHKKNLKEKQEEELLTTLPPPAPSQIHAVGSAID
RVVQEFGLHNENLDQRLEIKCAMENVFQHKLPDCSLRLYGSSCSRLGFRDSDVNIDVQFP
AVMSQPDVLLLVQECLKNSDCFIDVDADFHARVPVVVCRHKQSGLLCKVSAGNENAWLTT
KHLTALGKLEPRLLPLVIAFRYWAKLCSIDRPEEGGLPPYVFALMAVFFLQQRKEPLLPV
YLGSWIEEFSLNKLGNFSLKDVEKDSVVWEYTDNSTGDTSSPKEEALRETAAKKGQVPLT
FNIKHQPSVPVGQLWVELLRFYALEFNLADLVISIRVKELISRESKDWPKKRIAIEDPYS
VKRNVARTLNNQPVFEYILHCLRTTYKYFALPHKVTKPNLTKPPSPIICASDPYKEAKNC
GPELQVTNIDKLENALVAPDPGVQTSGSCRAQPLTFKKTTEELGSPSKETIRGVHIPVHQ
ESSGCVQAEASYEGFKDATAEQQEAGSDSENSRRKTKHLLSTDDQGLSSSKHPELQNCGS
LCGLQADNTLELVAEKCSSFASLDDKADVNERSTEGADERGEALNCFSPSVQSCTSATMH
FDEEEEEEEEEEEEEPRLRTNLTEDEEGVASENQVDSRYTGSGEDALSEDDDLAEPAKGE
DLEESGEHMGGALLIDLNRITLKEESFFEENSPGDQSEFFYEFRKLTFTKGKSPTVVCSL
CKREGHLKKDCPEDFKRIQLEPLPPLTPKFSNILDQVCIQCYKDFSPTIVEDQAREHIRQ
NLESFIKQDFPGTKLSLFGSSKNGFGFKQSDLDVCMTINGHETAEGLDCVRTIEELARVL
RKHSGLRNILPITTAKVPIVKFSHLRSGLEVDISLYNTLALHNTRLLFAYSAIDPRVKYL
CYTMKVFTKMCDIGDASRGSLSSYAYTLMVLYFLQQRSPPVIPVLQEIYKGEKKPEILVD
GWNIYFFDQINELPTCWPEYGKNTESVGQLWLGLLRFYTEEFDFKEHVISIRRKSLLTTF
KKQWTSKYIVIEDPFDLNHNLGAGLSRKMTNFIMKAFINGRRVFGIPVKGFPKDILAYFF
DPDVLTEGELAPNDRCCRICGKIGHFMKDCPMRRKVRRRRDQEDTPNQRYTESKEKRSKE
DKEIQNKYTEKEVSAKEDKAAPCTAAKAKPMRAAVDLGREKLVRTPAEKWKRQDDRDSRE
KRCFICGREGHIKKECPQFKGSPGSLSSKYMTQGRASVKRTQQES
Download sequence
Identical sequences ENSRNOP00000022373 10116.ENSRNOP00000060821 ENSRNOP00000060821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]