SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000000094 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000000094
Domain Number 1 Region: 17-90
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000254
Family Cold shock DNA-binding domain-like 0.0025
Further Details:      
 
Weak hits

Sequence:  10141.ENSCPOP00000000094
Domain Number - Region: 130-146
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000398
Family Retrovirus zinc finger-like domains 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000000094
Sequence length 241
Comment (Cavia porcellus)
Sequence
MNSGKPETMENLPDLYTIFQGEVAMVTDYGAFIKIPGCRKQGLVHRTHMSSCRVDKPSEI
VDVGDKVWVKLIGREMKNDRIKVSLSMKVVNQGTGKDLDPNNVIIEQEERRRRSFQDYTG
QKITLEAVLNTTCKKCGCKGHFAKDCFMQPGGTKYSLIPDEEEEKEEAKSAEFEKPDPTK
NSSRKRKKEKKKKKHRDRKSSDSDSSDSESDTGKRARHTSKDNKAAKKKKKKKKHKKKHK
E
Download sequence
Identical sequences H0UT69
10141.ENSCPOP00000000094 ENSCPOP00000000094 ENSCPOP00000000094 XP_003471286.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]