SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000001614 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000001614
Domain Number 1 Region: 199-235
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000103
Family Retrovirus zinc finger-like domains 0.0039
Further Details:      
 
Domain Number 2 Region: 63-87
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000144
Family CCCH zinc finger 0.0045
Further Details:      
 
Domain Number 3 Region: 145-172
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000392
Family CCCH zinc finger 0.004
Further Details:      
 
Weak hits

Sequence:  10141.ENSCPOP00000001614
Domain Number - Region: 38-59
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000916
Family CCCH zinc finger 0.0058
Further Details:      
 
Domain Number - Region: 119-143
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00392
Family CCCH zinc finger 0.0069
Further Details:      
 
Domain Number - Region: 91-119
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0262
Family CCCH zinc finger 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000001614
Sequence length 244
Comment (Cavia porcellus)
Sequence
MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHI
SGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESK
IKDCPWYDRGFCKHGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPP
LPQQTQPPTKQRAPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEKGHYANRCTKGHLAF
LSGQ
Download sequence
Identical sequences A0A1S3AKG4 A0A1U7R5P4 A0A250XX28 A0A286XUE3 B2LVG6
NP_001278177.1.92730 XP_001494983.1.31192 XP_003509727.1.69978 XP_003998511.1.62641 XP_004440896.1.5094 XP_004629700.1.9945 XP_004692007.1.23501 XP_004774998.1.14098 XP_005079971.1.91757 XP_005339793.1.77405 XP_005368121.1.66349 XP_006248932.1.100692 XP_006748328.1.47382 XP_006913414.1.64745 XP_006982731.1.50099 XP_007536344.1.11023 XP_007615091.1.28591 XP_008696585.1.72690 XP_011383906.1.92234 XP_013008089.1.53824 XP_014711467.1.49734 XP_016073266.1.3490 XP_019278180.1.44245 XP_019660373.1.58354 XP_020017328.1.5219 XP_021042898.1.100879 XP_021535893.1.83697 10141.ENSCPOP00000001614 ENSMUSP00000124966 ENSCPOP00000001614 ENSCPOP00000001614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]