SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000002278 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000002278
Domain Number 1 Region: 1113-1281
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 5.1e-44
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.0073
Further Details:      
 
Domain Number 2 Region: 965-1109
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 4.91e-40
Family Poly(A) polymerase, PAP, N-terminal domain 0.014
Further Details:      
 
Domain Number 3 Region: 428-489,534-631
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 9.89e-35
Family Archaeal tRNA CCA-adding enzyme substrate-binding domain 0.053
Further Details:      
 
Domain Number 4 Region: 272-461
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 4.5e-26
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.056
Further Details:      
 
Domain Number 5 Region: 1411-1443
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000471
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 
Domain Number 6 Region: 1309-1338
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000082
Family Retrovirus zinc finger-like domains 0.0052
Further Details:      
 
Domain Number 7 Region: 929-953
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000401
Family Retrovirus zinc finger-like domains 0.005
Further Details:      
 
Weak hits

Sequence:  10141.ENSCPOP00000002278
Domain Number - Region: 231-270
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000556
Family Classic zinc finger, C2H2 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000002278
Sequence length 1465
Comment (Cavia porcellus)
Sequence
MGDTAKPYVVKGTKGRGTVDDDDFRRGHLQQDYLIMDDYAKGHSSKMEKGLITPGNYGGT
ARKGPYPASNNPYAFKNPIYSQPVWMNDSHKDQSKRWQTDELAGNLDNWREFKPGPRIPV
ASRPRKDSFQESEESYRWQDGRGCRTVRCLFHKDLTSLETMSELEAGSSENNRKQRSRPR
KPRRTRNEECEQDGELEGPVIDESALSTKELLGLQQAEERLKRDFIDRLKRKPRNCPTAK
YTCRLCDVLIESVALAHKHIKEKRHKKNMKEKQEEELLTTLPPPAPSQVRAVGIAIDRVV
QEFGLHDKDLEQRLEVKRVVGNALQHKLPDCSLRLYGSSCSRLGFKNSDVNIDIQFPAIM
SQPDVLLLVQECLRNSDSFTDVDADFHARVPVVVCREKQSGLLCKVSAGNENACLTTKHL
SILGKLEPRLVPLVIAFRYWAKLCAIDRPEEGGLPPYVFCLMAIFFLQQRKEPLLPVYLG
SWIEGFSLKKLGNFNLKDVEEDFVIWEYTENAAGDANTAKEEAPKEMPVRRGQVSLMFDI
KHEPSVPVGQLWVELLRFYALEFNLADLVISIRVKESISRESKDWPKKRIAIEVTDPYSV
KRNVARTLNNQPVFEYILHCLRTTYKYFALPHKVGKSSLPKPLSPVSCVSEHSKEVVNYD
PGIQAKDDNRKNSVLAQSPGATTTSTTNTQKAQPLSLKEMMKSFGIPPAEEMGKEHSSTH
NEDTSCVRAQIERGSKNEKEKIRREGNCGELEACGSAHNDKAGGALQLDTLQNPVAEKSD
GFTILDDKVNDEESVEGTREPEVSVNHIATLIQGQTSEIIQFDEEEVEKEPGFTINQREV
EGDIANEDELDNSCTGSGDEDALSEEEDELVNPTKYEDLKECEKYVDGALLMELNKINLT
AENVQEENSPVDQSDFIYEFSKLIFTKGKSPTVVCNLCKREGHLKKDCPEDFRRIQLEPL
PPLTPKFSYILDQVCIQCYKDFSPNALEEQAREHIRQNLESFIRQDFPGTKLSLFGSSKN
GFGFKQSDLDICMTINGHETAEGLDCVRTIEELARVLRKHSGLRNILPITTAKVPIVKFF
HLRSGLEVDISLYNTLALHNTRLLSAYSAIDLRVKYLCYTMKVFTKMCDIGDASRGSLSS
YAYTLMVLYFLQQRSPPVIPVLQEIYKGEKKPEIFVDGWNIYFFDQIDELPTYWPEYGKN
TESVGQLWLGLLRFYTEEFDFKEHVISIRRKSLLTTFKKQWTSKYIVIEPPWDKNHNLGA
GLSRKMTNFIMKAFINGRRVFGIPVKGFPKDYPSKMEYFFDPDVLTEGELAPNDRCCRIC
GKIGHFMKDCPMRRKVRRRQNQEDTLHQRYAENKDKKSKEEKDIQNKHTEKETSAREDKP
VPCVAQKAKMARVAADPGREKMLRPLVERWKRQDSTDFREKRCFICGREGHIRKECPQFK
GSPGSLSSKSMTQGKASAKRSPQES
Download sequence
Identical sequences ENSCPOP00000002278 ENSCPOP00000002278 10141.ENSCPOP00000002278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]