SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000003210 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000003210
Domain Number 1 Region: 4-115
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.7e-35
Family Canonical RBD 0.0000565
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000003210
Sequence length 150
Comment (Cavia porcellus)
Sequence
MSSEEGKLFVGGLNFSTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHA
SDAMRAMNGESLDGRQIRVDHAGKSARGTRGGGAFGAHGRGRSYSRGGGDQGYGSGRYDS
RPGRSRDFSGRSQGGYDRYSGGNYRDSYDN
Download sequence
Identical sequences 10141.ENSCPOP00000003210 ENSCPOP00000003210 ENSCPOP00000003210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]