SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000003565 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000003565
Domain Number 1 Region: 169-220
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000000288
Family Retrovirus zinc finger-like domains 0.0023
Further Details:      
 
Domain Number 2 Region: 113-163
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000558
Family Retrovirus zinc finger-like domains 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000003565
Sequence length 261
Comment (Cavia porcellus)
Sequence
MTRWARVTTTRSKRPLPATSWEDMKEGSPQGRSSDLPKRHQSGAGRPPLKNDTPQEYLNE
DVNGFMEYLRQNSQMAPSGEVIATDSPEMREEIAVALKKDSRREGRRLKRQAAKKNAMVC
FHCRKPGHGVADCPAALENQEMGTGICYRCGSTEHEITKCKAKVDPALGEFPFAKCFVCG
EMGHLSRSCPENPKGLYADGGGCKLCGSVEHLKRDCPEGQHADRAVTVGRWAKGMSADYE
EVMDAPKVQKPKAKTPKVVHF
Download sequence
Identical sequences ENSCPOP00000003565 10141.ENSCPOP00000003565 ENSCPOP00000003565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]