SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000004574 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000004574
Domain Number 1 Region: 1073-1245
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.22e-47
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.0088
Further Details:      
 
Domain Number 2 Region: 472-533,596-694
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 5.3e-38
Family 2'-5'-oligoadenylate synthetase 1, OAS1, second domain 0.07
Further Details:      
 
Domain Number 3 Region: 938-1069
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 6.07e-34
Family Poly(A) polymerase, PAP, N-terminal domain 0.021
Further Details:      
 
Domain Number 4 Region: 314-506
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 2.2e-27
Family Archaeal tRNA CCA-adding enzyme catalytic domain 0.047
Further Details:      
 
Domain Number 5 Region: 1305-1345
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000297
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 
Domain Number 6 Region: 1265-1293
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000331
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 
Weak hits

Sequence:  10141.ENSCPOP00000004574
Domain Number - Region: 888-912
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00023
Family Retrovirus zinc finger-like domains 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000004574
Sequence length 1618
Comment (Cavia porcellus)
Sequence
MERPTTSKSENHEPKNVICEESKPVKVTTNQTLKARNDKSVKEIGSSSRNHESRDQSHAK
QKNYPNSPVKAEKIPATSQAKLEKPSLQAKAEKTPKPPNLPVKAEKAPFSPAAAAATKAL
SAQRKSEKVSSSHIKSEKVASVSSADPEKVSSLLLKENKRQTELQQTASSSANKVNIETV
QREKSALERLSQSQKQQTRTDNNGDSDDSASGIEDVLDDSSKYKLEPLSLEKSSEVDYFV
NAAVLNSGIWYERSVNFKQVLETMLQNLVFKLFARSPEYTNCRYLCKLCLIHIENIQGAH
KHIKEKRHKKNILEKQEESELRSLSPPSSAHLAALSVAVVEIAKEQGITDEDLKARQEIV
EEMSKVITTFLPECSLRLYGSSLTKFALKSSDVNIDIKFPSTMNHPDLLIQVLGIYKPPV
LYVDVESDFHAKVPVVICKDRKRSGLLCRVSAGNDTACLTTDLLAALGKMEPVFTPLVLA
FRYWAKLCYIDSQTDGGIPSYCFVLMTMFFLQQRKPPILPCLLGSWIEGFDPKRMDDFQL
KGIVEEKFVKWEYKSSSATEKNSIAEENKAKADQPKDDTKKTETVNQSNAMKEKHGKSPL
TLETPNQVSLGQLWLELLKFYTLDFALEEYVICVRIQDILTRENKNWPKRRIAIEVDPFS
VKRNVARSLNSQLVYEYVVERFRAAYRYFACPQRKGENKSTVPFKKKDKGKISNKKPVKS
DNVATSCSVLLGENTEKINTESGQSDKHDTECTSQRCIVKNDHLLVNELDLADHGQESSS
LSVANEGTELEPKSVKKIDGLVPLQTCFKKELGQCNCIGSADPDESAGTDCRSNLEIENS
HRIMCIDTSATSCKCKATEVASDLNDDDNLPSQELYYVFDKFILTSGKPPTIVCSICKKD
GHSKNDCPEDFRKIDLKPLPPMTNRFREILDLVCKRCFVDELSPPFSEQYNREQILIGLE
KFIQKEYDEKARLCLFGSSKNGFGFRDSDLDICMTLEGHENAEKLNCKEIIENLAKILKR
HPGLRNILPITTAKVPIVKFEHRRSGLEGDISLYNTLAQHNTRMLATYAAIDPRVQYLGY
TMKVFAKRCDIGDASRGSLSSYAYILMVLYFLQQRKPPVIPVLQEIFDGKQIPQRMVDGW
NAFFFDKTEELKKRLPSLGKNTESLGELWLGLLRFYTEEFDFKEYVISIRQKKLLTTFEK
QWTSKCIAIEDPFDLNHNLGAGVSRKMTNFIMKAFINGRKLFGTPFYPLIGREAEYFFDS
RVLTDGELAPNDRCCRVCGKIGHYMKDCPKRKSYIIIKIKKKFQIYYKNDSRDTHDTRDV
RDPRDLRCFICGDAGHVRRECPEVKLARQRNSSVAAAQLVRNLVNAQQVAGSAQQQGDQS
IRTRQSSECSDSPSYSPQPQPQPFPQNSSQSAAVTQPPSQSGSQPKLGPPQQGAQASHQV
QMPMYNFPQSPPAQYSPMHNMGLLPMHPLQIPAPSWPIHGPVIHSAPGSAPSSIGLNDPS
IIFAQPAARPMAIPNSSHDGHWPRTVAPNSLLNNGAVGNSGNAEPGFRGLNPPIPWEHAP
RPHFPLVPASWPYGLHQNFMHQGNTRFQPNKPFYTQDRCATRRCRERCPHPPRGNVSE
Download sequence
Identical sequences 10141.ENSCPOP00000004574 ENSCPOP00000004574 ENSCPOP00000004574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]