SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000005571 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000005571
Domain Number 1 Region: 55-126
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000245
Family Cold shock DNA-binding domain-like 0.00065
Further Details:      
 
Domain Number 2 Region: 148-193
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000861
Family Retrovirus zinc finger-like domains 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000005571
Sequence length 276
Comment (Cavia porcellus)
Sequence
IDAEERAVPKGKFSSLESGAEGPWGNMAEGGAGRGGGEEPGKLPEQAGEESQVLHGTGHC
KWFNVRMGFGFISMINREGSPLDIPVDVFVHQSKLFMEGFRSLKEGEPVEFTFKKSSKGL
ESLRVTGPGGTPCLGSERRPKGKTLQKRKPKGDRCYNCGGLDHHAKECSLPPQPKKCHYC
QSVMHMVANCPLKTVAQLPASSQGRPEAEPQPCTSASPRAGGGGPGRTSPPRPPEARAGG
PERPGRSPPEASSAKASAASEEPSKKGPSVQKRKKT
Download sequence
Identical sequences ENSCPOP00000005571 10141.ENSCPOP00000005571 ENSCPOP00000005571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]