SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000006590 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000006590
Domain Number 1 Region: 24-197
Classification Level Classification E-value
Superfamily TIMP-like 3.14e-68
Family Tissue inhibitor of metalloproteinases, TIMP 0.00000418
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000006590
Sequence length 211
Comment (Cavia porcellus)
Sequence
MAPWLGLVVLLGSWSLGPWGAEACTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTM
VYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNF
VERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSK
HYACIRQKGGYCSWYRGWAPPDKSVINATDP
Download sequence
Identical sequences A0A286XFC8
XP_003462363.1.53824 ENSCPOP00000006590 10141.ENSCPOP00000006590 ENSCPOP00000006590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]