SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000008173 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000008173
Domain Number 1 Region: 183-335
Classification Level Classification E-value
Superfamily Cap-Gly domain 5.63e-43
Family Cap-Gly domain 0.0000000847
Further Details:      
 
Domain Number 2 Region: 31-128
Classification Level Classification E-value
Superfamily Cap-Gly domain 1.31e-35
Family Cap-Gly domain 0.00000248
Further Details:      
 
Weak hits

Sequence:  10141.ENSCPOP00000008173
Domain Number - Region: 1398-1432
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00663
Family Retrovirus zinc finger-like domains 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000008173
Sequence length 1437
Comment (Cavia porcellus)
Sequence
MSMLKPSGLKAPTKILKPGSTALKTPATVVSSVEKTTSSEKVSSTPSSETQEEFVDDFRV
GERVWVNGNKPGYIQFLGETQFAPGQWAGIVLDEPIGKNDGSVAGVRYFQCEPLRGIFTR
PSKLTRKVQVEDEANGLQMAHVSRAASPLSTSAASTAGSCLAMASHVPHKSSQPTAKEPA
ATPQVSNLTKTTSESISNLSEAGSIKKGERELKIGDRVLVGGTKAGVVRFLGETDFAKGE
WCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGFPSTTPAKAKAAAVRRVM
ATTPASLKRSPSASSLSSMSSVASSVSSKPSRTGLLTETSSRYARKISGTTALQEALKEK
QQHIEQLLAERDLERAEVAKATSHVGEIEQELALARDGHDQHVLELEAKMDQLRTMVEAA
DREKVELLNQLEEEKRKVEDLQFRVEEESITKGDLEQKKHISEDPENTQTKLEHARIKEL
EQSLLFEKTKADKLQRELEDTRVATVSEKSRIMELEKDLALRVQEVTELRRRLESNKPAG
DVDMSLSLLQEISSLQEKLEVTHTDHQREITSLKEQFGAREETHQKEIKALHSAMEKLSK
ENESLRSKLDHANKENSDVIALWKSKLQTAIASHQQAMEELKVSFKGLEMETAEQAKLKM
QIDKLKVDYQQEIENLQNKQDFERSAHAKEMEALRANLMNVIKEKENSLEAIKSKLDKAE
DQHLVEMEDTLNKLQEAEIKVKELEVLQAKCNEQTKVIDNFTSQLKATEEKLLDLDVLRK
TSSEGKLEIEKLRQQLEAAEKQIKNLEIEKNAESGKASSITKELQGKELKLTSLQDNLSE
VSQVKEALEKELQMLKENFAVVSEEAVSVQRSMQETVNKLHEKEKEFDQLSSELEKLREN
LADMEVKFRERDEREEYLLKAKEKLENDIADIMKMSGDNSSQLTKMNDELRLKERCVEEL
QLQLTKANENANTLQKSIGEITLKAEQSQQEIARKHEEEKKALEEKLLDLEKEMETSHNQ
YEDLKARYEKASSETKTKHEEILQNLRKMLLDTGERLKAVQEENRGLTQEVEELRIQADK
AKASQTAEDAMQIVEQMTKEKTETLASLEDTKQTNAKLQNELDTLKENNLKNMEELNKSK
ELLTVENQKMEEFRKEIETLKQAAAQKSQQLSALQEENVKLAKELGRSRDEVTSHQKLEE
ERSVLNNQLLEMKKRESEYIKEADEEKASLQKSISVTSALLTEKDAELEKLRNEVTVLRG
ENASAKSLHSVVQTLESDKVKLELKVKNLELQLKENRRQLSSSSGNTDTQAEEDERAQES
QIDFLNSVIVDLQRKNQDLKMKVEMMSEAALNGNGDDLNSYDSDDQEKKSKKKPRLFCDI
CDCFDLHDTEDCPTQTQISEDPPHSTHHGSRSEERPYCEICEMFGHWATNCNDDETF
Download sequence
Identical sequences A0A286Y5G5
ENSCPOP00000008173 ENSCPOP00000008173 XP_013000241.1.53824 10141.ENSCPOP00000008173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]