SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000008433 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000008433
Domain Number 1 Region: 35-617
Classification Level Classification E-value
Superfamily Prokaryotic type I DNA topoisomerase 1.57e-162
Family Prokaryotic type I DNA topoisomerase 0.0000163
Further Details:      
 
Domain Number 2 Region: 646-687
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00000374
Family Prokaryotic DNA topoisomerase I, a C-terminal fragment 0.095
Further Details:      
 
Weak hits

Sequence:  10141.ENSCPOP00000008433
Domain Number - Region: 967-999
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0921
Family Retrovirus zinc finger-like domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000008433
Sequence length 1002
Comment (Cavia porcellus)
Sequence
MIFSVLRHPLRWLGRPRGRALSLATMEVAFRGVRKVLCVAEKNDAAKGIADLLSNGRMRR
REGLSKFNKIYEFDYYLYGQNVTMIMTSVSGHLLAHDFQMQFRKWHSCNPLVLFEAGIEK
YCPENFIDIKKTLERETRQCQALVIWTDCDREGENIGFEIIHVCKAVKPSLQVLRARFSE
ITPHAVRTACQNLTEPDQRVSDAVDVRQELDLRIGAAFTRFQTLRLQKVFPEVLAEQLIS
YGSCQFPTLGFVVERFKAIQAFVPEIFHRIKVTHDHEDGIVDFNWKRHRLFNHTACLVLY
QLCMEDPMATVVEVRSKPKSKWRPQALDTVELEKLASRKLKINAKETMRIAEKLYTQGYI
SYPRTETNIFPKDLNLMALVEQQTQDPHWGPFAQSILERGGPTPRNGNKSDQAHPPIHPT
KYTSNLQGDERRLYEFIVRHFLACCSQDAQGQETTVEIDIARERFVANGLTILARNYLDV
YPYDRWSDKLLPVYEEGSHFQPSTIEMLDGETSPPQLLTEADLIALMEKHGIGTDATHAE
HIETIKARMYVGLTSDKRFLPGHLGMGLVEGYDSMGYEMSKPDLRAELEADLKLICEGKK
DKSVVLRQQVQKYKQVFIEAVAKAKKLDEALSQYFGEGTETLQQEEIYPAMPEPILKCPQ
CNKDLVLKTKKSGGFYLSCTGFPECRLAMWFPDSVLEVSRDGSVCPVCQPAPVYRLKFRF
KRGSLPPTMPLEFVGCIGGCDETLKEILGLRFSRGPPRGSQPSGHLQASQSVNRMDSSHS
RPPGSRLTRPSQAQAQNLLLPAAATGESNSVTCNCGQEAVLLTVRKDGPNQGRQFYKCST
GACSFFLWADSSPPGAGGALDSASRLPGSSFGHPAGPGHHADGFSSNPSGGSGSGTFCLC
SHPAVTRTVQKDGPNKGRQFHTCAKPREQQCGFFQWADENTAPGTFTALPWPRGRGKTQG
PEARSKRAGTTSSDPGSTTKKSRKCSLCHQPGHTRPFCHQNR
Download sequence
Identical sequences H0VEI8
XP_003465949.1.53824 ENSCPOP00000008433 ENSCPOP00000008433 10141.ENSCPOP00000008433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]