SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000008447 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  10141.ENSCPOP00000008447
Domain Number - Region: 252-282
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00445
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000008447
Sequence length 950
Comment (Cavia porcellus)
Sequence
MGVPAFFRWLSRKYPSIIVNCVEEKPKECNGVKVPVDASKPNPNDVEFDNLYLDMNGIIH
PCTHPEDKPAPKNEDEMMVAIFEYIDRLFNIVRPRRLLYMAIDGVAPRAKMNQQRSRRFR
ASKEGMEAAVEKQRVREEILAKGGYLPPEEIKERFDSNCITPGTEFMDNLAKCLRYYIAD
RLNNDPGWKNLTVILSDASAPGEGEHKIMDYIRRQRAQPNHDPNTHHCLCGADADLIMLG
LATHEPNFTIIREEFKPNKPKPCGLCNQFGHEVKDCEGLPREKKGKHDELADSLPCAEGE
FIFLRLNVLREYLERELTMASLPFTFDVERSIDDWVFMCFFVGNDFLPHLPSLEIREGAI
DRLVNIYKNVVHKTGGYLTESGYVNLQRVQMIMLAVGEVEDSIFKKRKDDEDSFRRRQKE
KRKRMKRDQPAFTPSGILTPHALGSRNSPGSQVASNPRQAAYEMRMQTNSSPSVSPNTSF
TSDGSPSPLGGIKRKAEDSDSEPEPEDNVRLWEAGWKQRYYKNKFDVDAADEKFRRKVVQ
SYVEGLCWVLRYYYQGCASWKWYYPFHYAPFASDFEGIADMPSDFEKGTKPFKPLEQLMG
VFPAASGNFLPPSWRKLMSDPDSSIIDFYPEDFAIDLNGKKYAWQGVALLPFVDERRLRA
ALEEVYPDLTPEENRRNSLGGDVLFVGKHHPLHDFISELYRTGSTEPVDVPPELCHGIQG
KFSLDEEAILPDQVVCSPVPMLRDLAQNTAISINFKDPQFAEDYVFKAILLPGARKPAAV
LKPSDWEKSSNGRQWKPQLGFNRDRRPVHLDQAAFRTLGHIMPRGSGTGVYSNTAPPPAT
YQGSLYRPLLRGQAQIPKLMSNMRPQDSWRGPPPLFQQQRFDRGVGAEPLLPWNRMLQTQ
NAAFQPNQYQMLAGPGGYPPRRDDRGGRQGYPREGRKYPLPPPSGRYSWN
Download sequence
Identical sequences H0VEJ7
ENSCPOP00000008447 ENSCPOP00000008447 10141.ENSCPOP00000008447 XP_003476505.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]