SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000009719 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000009719
Domain Number 1 Region: 11-44
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000128
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000009719
Sequence length 177
Comment (Cavia porcellus)
Sequence
MATPMHRLIARRQAEANKQHVRCQKCLEFGHWTYECTGKRKYLHRPSRTAELKKALKEKE
NRLLLQQSIGETNVERKTKKKSRAKSVTSSSSDSSDSSASDSSSGSEDTSTSSSSSEDSD
SDESSSSSSSSASSTSSSSSSSSSSDSDSDSSSTSSSSSSSSGSSSEEEPPKKRKKK
Download sequence
Identical sequences ENSCPOP00000009719 ENSCPOP00000009719 10141.ENSCPOP00000009719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]