SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000009849 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  10141.ENSCPOP00000009849
Domain Number - Region: 12-35
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000128
Family Retrovirus zinc finger-like domains 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000009849
Sequence length 67
Comment (Cavia porcellus)
Sequence
CISGCNKDSVRAGCKKCGYPGHLTFECRNFLRVDPKRDIVLDVSSTSSEDSDEENEELNK
LQALQEK
Download sequence
Identical sequences ENSCPOP00000009849 ENSCPOP00000009849 10141.ENSCPOP00000009849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]