SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000009866 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000009866
Domain Number 1 Region: 273-584
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 7.46e-64
Family Enolase 0.0002
Further Details:      
 
Domain Number 2 Region: 68-165,225-265
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.77e-23
Family Enolase N-terminal domain-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000009866
Sequence length 622
Comment (Cavia porcellus)
Sequence
MGEEGGGRSCGTTRELQKLKQQAMEYYRENDVPRRLEELLNSTFYLQPADVYGHLKANCF
SKLAKPPTICKIMGKSVLDGLGLPTLQVEVFCTIQNFHKSICSVMVPTYFEVHENALPEL
VEAEGEERNLAVSTAVQWVNEAITQELQGLVPSNQADVDCTLRTFFANKVQEDKQRKELE
KSQEDSAGPIPPPQTLPPPPPPPTKKKGQKPGKKDSLVEKPIAPAEPAEPVLCGSMAIGA
VSLAVAKTSAILGSNPLYLNIAFLKHGQEQSSTLTVPLIMASVVSCGKSSPGKLNLMKEV
ICIPHPGLTTKQGMEMLLEIQKQINKTLEVPPPPKAENKKGHNGNKRGQQSLTGRMSHLG
CLTLSCDTVEQPLLLLQGVCANLELELGTHLHLAINCAGHELMDYSKGKYEVLTGTHKSA
AEMVDLYVELVNKNPSIIALIDPFRKEDSEQWDSLYNALGSRCYIIAGKASKSISKLLEH
GNISIPRSHALIITHTNQTTVSDLVEITNLIDSTKHIAILGSTDGESCDDSLVDLAVGLG
VRFIKLGGLSRGERVTKYNRLLTIEEELVQNGTLGFNEEHIFFHFNEDAEKVPEAAGAAA
GELPGLLEPIFPTEVVEQSAQS
Download sequence
Identical sequences 10141.ENSCPOP00000009866 ENSCPOP00000009866 ENSCPOP00000009866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]