SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000012130 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000012130
Domain Number 1 Region: 229-276
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000272
Family Retrovirus zinc finger-like domains 0.0015
Further Details:      
 
Weak hits

Sequence:  10141.ENSCPOP00000012130
Domain Number - Region: 337-362
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000173
Family Retrovirus zinc finger-like domains 0.0053
Further Details:      
 
Domain Number - Region: 296-321
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000586
Family Retrovirus zinc finger-like domains 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000012130
Sequence length 472
Comment (Cavia porcellus)
Sequence
MFGGYETIEAYEDDLYREESSSELSVDSEVEFQLYSQVHYAQDLSNAIREEGLEEKNSGN
SELNTEVHQNLIVLSDSEVIQLSDESDVITLSDEDSIYRCKRKNIRVQTQKKTRGPPASP
YSDELADQKCKQEIEKPKPEERSGVTQEVMVIEVSSSEEEESITSESENVESWMLLGCEV
DEKDDDILLNLVGCESSVTEDDVHWFISDKDVEAQIGNNRSSGRWTRRYYSADKNVTCRN
CDKCGHLSKNCPLPQKVRACCLCSERGHLQYSCPARFCLDCSLPMSSTHRCLERSSWRKR
CDRCDMIGHYADACPEIWRQYHLTTKPGPPKKPKTPSGQSAFVYCYNCAQKGHYGHECTE
RRMFNQTFPTSPFIYYYDDKYEIRERDQRIKRKVKELKKNGDFPRQFKRSYMEAADKRPH
NDKRKSYASQENYRWHQGDKEAQREMMSRSRDPEKHRKVGRHWEANEDFPRG
Download sequence
Identical sequences 10141.ENSCPOP00000012130 ENSCPOP00000012130 ENSCPOP00000012130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]