SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000012431 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000012431
Domain Number 1 Region: 541-566,608-688
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.29e-16
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000012431
Sequence length 702
Comment (Cavia porcellus)
Sequence
MDVSPNTPQQGGSLVLVRRQPPKPRGLVETLKARLQQSCRCSMPQAWALVQDLIPVTHWL
CQYRPREYLAGDVMSGLVIGIILVPQAIAYSLLAGLQPIYSLYTSFFANLIYFLLGTSHH
VSVGIFSLLCLVVGQVVDRELQLAGFDPSQDGLGSRENGSILNSSVTTLEPGLQDCGRDC
YAIRVATALTLMTGIYQVLMGVLQLGFVSAYLSQPLLDGFAMGASVTILTSQLRHMLGVR
VPRHQGPGMVVRTWLSLLHGLGEANVCDVVTSGVCLVVLLAGKELSDRYRRHLRVPLPTE
LLVIVVATLVSHFGQLHRRFGSNVAGDIPTGFVPPQAPDLELMQHVALDAVSLALVGSAF
SISLAEMFARSHGYSVRANQELLAVGCCNVLPAFFHCYVTGAALSKSLVKTATGCRTQVS
SLVSAAVVLLVLLVLAPLFQDLQRSVLACVIVASLRGALRKVRDLPQLFRLSPADALVWA
ATAATCVLVSVEAGLLTGLLLSLLSLVGRTQRPKAALLARIGDSAFYEDATEFEGLVPPA
GVQVFRFAGPLCYANKAFFLRSLYSLTGLDVGCSAARRKAQGLELGAAEGDPVEGKDPVS
SGARLVPMAAGFHTVVIDCAPLLFLDMAGIAMLQDLRRDYRALGVNLLLACCSPSVRDTL
QKGGFLGEDQGMEDEQLFPSVHSAVEAAQARYGELVATNSVL
Download sequence
Identical sequences H0VPK2
XP_005001598.1.53824 XP_013002795.1.53824 ENSCPOP00000012431 ENSCPOP00000012431 10141.ENSCPOP00000012431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]