SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000012444 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000012444
Domain Number 1 Region: 21-113
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.55e-23
Family Canonical RBD 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000012444
Sequence length 190
Comment (Cavia porcellus)
Sequence
MEAETKTLPLENASILSEGSLQEGHRLWIGNLDPKITEYHLLKLLQKFGKVKQFDFLFHK
SGALEGQPRGYCFVNFETKQEAEQAIQCLNGKLALSKKLVVRWAHAQIKRYDHNKNDKIL
PISLEPSSSTEPTQSNLSVTAKIKAIEAKLKMMAENPDAEYPAAPVYSYFKPPDKKRTNP
YSRTAWKSRR
Download sequence
Identical sequences A0A286XRG9
ENSCPOP00000012444 XP_003470862.1.53824 XP_005004099.1.53824 10141.ENSCPOP00000012444 ENSCPOP00000012444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]