SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000012687 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000012687
Domain Number 1 Region: 39-165
Classification Level Classification E-value
Superfamily PX domain 0.00000000000000327
Family PX domain 0.0075
Further Details:      
 
Domain Number 2 Region: 805-833
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000227
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000012687
Sequence length 863
Comment (Cavia porcellus)
Sequence
NNSAHGDFLQSNETNLIEQAPIPQDGPTVVPHRTQREAVHIEKIMLKGVQKKRADKYWEY
TFKVNWSDLSVTTVTKTHQELQEFLLKLPKELSSETFDKTILRALNQGSLKREERRHSDL
EPILRQLFSTSSQAFLQSQKVHSFFRSISSDSLHNLNNLQSSLKTSKILEHLKEDSSEAS
SQEEDVLQHTIIHKKHTGKSPIVNSIGTSCSPLDGITVQYPEQNGVVDWRKQSCTAVQHP
EHCVSLADQHSAEKRSLSSINKKKGKPQIEKEKIKKTDNRLNSRINGIRLSTPQHTHGGT
VKDVNLDIGSGHDTCGETSSESYSSPSSPRHDGRESFESEEEKDRDTDSNSEDSGNPSST
RFTGYGPVNQTVKPPVPIASLGNENGNLLEDTLNSPKYPHIPFMPTLHCVMHNGAQKSEI
VVPPPKSADGKTIGMLVPSPVAISALRESTNSAPVGILGPTASNGESEKHLELLASPLPI
PSTFLPHSSTPALHLTFQRLKLPPPQGSSESCTVNIPQQPAGSLNIGSPNTAFIPVHNPG
SFPGSPVATTEPITKSASQVVGLNQMVPQIEGNTGTVPQPTNVKVVLPAAGLSAAQPPAS
YTLPGSPLAASVLPTQNSNVLNTAATSAQPASAGISQAQSTVPPAVPTHTPGPAPSPSPA
LTHSTAQSDSTSYISAVGNTNANGTIVPPQQMGSGPCGSCGRRCSCGTNGNLQLNSYYYP
SPMPGPMYRVPSFFTLPSICNGSYLNQAHQSNGNQLPFFLPQTPYANGLVHDPVMGSQAN
YGMQQMAGFGRFYPVYPAPNVVANTSGSGPKKNGNVSCYNCGVSGHYAQDCKQSSMEANQ
QGTYRLRYAPPLPPSNDTLDSAD
Download sequence
Identical sequences ENSCPOP00000012687 10141.ENSCPOP00000012687 ENSCPOP00000012687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]