SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000013114 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000013114
Domain Number 1 Region: 7-98
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.09e-29
Family Canonical RBD 0.0025
Further Details:      
 
Domain Number 2 Region: 95-123
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000101
Family Retrovirus zinc finger-like domains 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000013114
Sequence length 204
Comment (Cavia porcellus)
Sequence
MSGGLAPSKSTVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKSKGVAFILFLD
KDSAQNCTRAINNKQLFGRVIKASIAIDNGRAAEFIRRRNYFDKSKCYECGESGHLSYAC
PKNMLGEREPTTEQEEIEDPAGSEDEGEDPALDSLSQAIACQQAKVEEQNKWKPSAGGPS
TSEDSRRPRIKKSAYFSDEEELSD
Download sequence
Identical sequences ENSCPOP00000013114 10141.ENSCPOP00000013114 ENSCPOP00000013114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]