SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000013126 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000013126
Domain Number 1 Region: 519-550,632-706
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000179
Family Anti-sigma factor antagonist SpoIIaa 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000013126
Sequence length 754
Comment (Cavia porcellus)
Sequence
MIEPIGNQYVVARPVYSANAFGEDHKKIERRHKTLLEHLKKWCGCSTKKAKRIVLSFFPV
ASWLPGYRLKEWLLSDIVSGISTGLVAVLQGLAFALLVTIPPRYGLFAAFFPVISYFFLG
TSRHISVGPFPVLSTMVGAVVTRVIASTNSTSVLDSDEPSLEEKKLVVAASVTVLSGIIQ
LALGALQIGFVVIYLSESLISGFTTAAAIHVLVSQLKFMLQLSVPAHTDPFSIFKVLISV
FSQIEKTNIADLVTSLVILVIVFVVKEINQRFIAKLPVPIPIELIVTVIATGVSYGFNFE
QRFNVSVVGTMKQGFEPPITPDVTVFQQTIGDCFGIAIVGFAVAFSVASVYSLKYDYPLN
GNQELIAFGVSNIFTGAFKGFAGSTALSRSGVQESTGGKTQIAGLLSAIIVLIVIVAIGF
LLAPLQKSVLAALALGNLKGMLMQFAEIGRLWKKDKYDCLIWVMTFIFAIVLGLGLGLAA
SVAFQLLTIVFRTQFPKCSTLANVGRSNIYKNVKDYSEMYEPEGVKIFRCPSPIYFANIG
FFKQKLTDVIGFSPLRVLRKRNKALKKLRKLHSKGLLQVTPKGYICTTDSFKDSDEELDN
NQIEELDQPINTTDLPFQIDWNADLPFNIVVPKISLHSLILDFSAVSFLDVSSMRGLKTL
LQEFARINVDVYIVGTDDDFIEKLTRCQFFDDEVKDSMFFLTIHDAVLHVLMKKDYSTSK
FNSNQQKETKFDFTINTNGGLRNRECQVPYETKF
Download sequence
Identical sequences H0VRC0
10141.ENSCPOP00000013126 ENSCPOP00000013126 ENSCPOP00000013126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]