SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000014409 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000014409
Domain Number 1 Region: 176-373
Classification Level Classification E-value
Superfamily E set domains 5.6e-75
Family Cytoplasmic domain of inward rectifier potassium channel 0.00000141
Further Details:      
 
Domain Number 2 Region: 74-192
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.35e-22
Family Voltage-gated potassium channels 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000014409
Sequence length 439
Comment (Cavia porcellus)
Sequence
MGLAKALRRLSGALESGNSREGNSRPDDEEAAGPGLCRNGWAPAQGPGARRRGRFVKKDG
HCNVRFVNLGGQGARYLSDLFTTCVDVRWRWMCLLFSCSFLASWLLFGLAFWLIASLHGD
LAAPPPPAPCFSHVASFLAAFLFALETQTSIGYGVRSVTEECPAAVAAVVLQCIAGCVLD
AFVVGAVMAKMAKPKKRNETLVFSENAVVALRDRRLCLMWRVGNLRRSHLVEAHVRAQLL
QPRVTPEGEYIPLDHQDVDVGFDGGTDRIFLVSPITIVHEIDSASPLYELGRAELARADF
ELVVILEGMVEATAMTTQCRSSYLPGELLWGHRFEPVLFQRGSQYEVDYRHFHRTYEVPG
TPVCSAKELDERAEQNAHSPKSSFPGSLAAFCYENELALSCCQEEDEEEETKEETGAETE
DGAASPRVITPTLALSLLP
Download sequence
Identical sequences Q9EP58
ENSCPOP00000014409 10141.ENSCPOP00000014409 ENSCPOP00000014409 NP_001166591.1.53824 XP_005001757.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]