SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000015653 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000015653
Domain Number 1 Region: 137-178
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000262
Family Retrovirus zinc finger-like domains 0.0023
Further Details:      
 
Weak hits

Sequence:  10141.ENSCPOP00000015653
Domain Number - Region: 41-94
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000143
Family Cold shock DNA-binding domain-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000015653
Sequence length 210
Comment (Cavia porcellus)
Sequence
MGSVSNQQFTGGCAKAAEKAPEEAPADAARAADEPQLLHGAGICKWFNVRMGFGFLSMTA
RAGVALDPPVDVFVHQVRLILVGFRSHGGGEDVQISGSRVRGNLKLTVMTLPAPKICRNS
EDRKPKSKGLESRRSISVRCYNCGGLDHHAKECKLPPQPKKCHFCQSINHMVASCPLKAQ
QAPSSQGKPAYFQEEEEEINNPALLPEAQN
Download sequence
Identical sequences ENSCPOP00000015653 ENSCPOP00000015653 10141.ENSCPOP00000015653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]