SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000017549 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  10141.ENSCPOP00000017549
Domain Number - Region: 53-81
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00207
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 
Domain Number - Region: 70-120
Classification Level Classification E-value
Superfamily F1 ATPase inhibitor, IF1, C-terminal domain 0.0497
Family F1 ATPase inhibitor, IF1, C-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000017549
Sequence length 146
Comment (Cavia porcellus)
Sequence
LFSSYEKPPPGLIKEDESKPEDCIPDVPGNEHAREFLAHAPTKGLWMPLGKEVKVMQCWR
CKRYGHRTGDKECPFFIKGNQKLEQFRVAHEDPMYDIIRENKRHEKDVRPRIQQLKQLLA
DSTSEEDGSSSESSEAKSYHKDYQCL
Download sequence
Identical sequences ENSCPOP00000017549 ENSCPOP00000017549 10141.ENSCPOP00000017549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]