SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000018612 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000018612
Domain Number 1 Region: 134-326
Classification Level Classification E-value
Superfamily E set domains 5.13e-63
Family Cytoplasmic domain of inward rectifier potassium channel 0.00000826
Further Details:      
 
Domain Number 2 Region: 26-150
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.49e-20
Family Voltage-gated potassium channels 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000018612
Sequence length 335
Comment (Cavia porcellus)
Sequence
RHSRQRARLVSKDGRCNIEFGNVDARSRFIFFVDIWTTVLDLKWRYKMTVFISAFLGSWF
LFGLLWYVVAYTHKDLPEFHPPDNHTPCVENINGMTSAFLFSLETQVTIGYGFRCVTEQC
ATAIFLLIVQSILGVIINSFMCGAILAKISRPKKRAKTITFSKNAVISKRGGKLCLLIRV
ANLRKSLLIGGHIYGKLLKTTVTPEGETIILDQTNLNFVVDAGNENLFFISPLTILPLLF
FHMAAETLSQQDFELVVFLDGTVESTSATCQVRTSYVPEEVLWGYRFVPIVSKTKEGKYR
VDFHNFSKTVQVETPHCAMCLYNEKDARASIKLGY
Download sequence
Identical sequences 10141.ENSCPOP00000018612 ENSCPOP00000018612 ENSCPOP00000018612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]