SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000018639 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000018639
Domain Number 1 Region: 127-246
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.31e-26
Family Eukaryotic type KH-domain (KH-domain type I) 0.000000366
Further Details:      
 
Weak hits

Sequence:  10141.ENSCPOP00000018639
Domain Number - Region: 266-288
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000331
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000018639
Sequence length 645
Comment (Cavia porcellus)
Sequence
PLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTG
DLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFKPPAD
YKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKV
GRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELA
RLNGTLREDDNRILRPWQSSETRSITNTTVCTKCGGAGHIASDCKFQRPGDPQSAQDKAR
MDKEYLSLMAELGEAPVPASVGSTSGPTATPLASAPRPAAPANNPPPPSLMSTTQSRPPW
MNSGPSESRPYHGMHGGGPGGPGGGPHSFPHPLPSLTGGHGGHPMQHNPNGPPPPWMQPP
PPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMGMMPPPPPPPSGQ
PPPPPSGPLPPWQQQQQQPPPPPPPSSSMASSTPLPWQQNTTTTTTSAGTGSIPPWQQQQ
AAAAASPGAPQMQGNPTMVPLPPGVQPPLPPGAPPPPPRSIECLLCLLSSPNSLCLSPNW
AARIPPRGGDGSSHESEDFPRPLVTLPGRQPQQRPWWTGWFGKAA
Download sequence
Identical sequences ENSCPOP00000018639 10141.ENSCPOP00000018639 ENSCPOP00000011053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]