SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000018762 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000018762
Domain Number 1 Region: 17-91
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000224
Family Cold shock DNA-binding domain-like 0.0026
Further Details:      
 
Weak hits

Sequence:  10141.ENSCPOP00000018762
Domain Number - Region: 130-146
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00023
Family Retrovirus zinc finger-like domains 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000018762
Sequence length 186
Comment (Cavia porcellus)
Sequence
MNSGKPETMENLPDLYTIFQGEVAMVTDYGAFIKIPGCRKQGLVHRTHMSSCRVDKPSEI
VDVRDKVWVKLIGREMKNDRIKVSLSMKVVNQGTGKDLDPNNVIIEQEERRRRSFQDYTG
QKITLEAVLNTTCKKCGCKGHFAKDCFMQPGGTKYSLIPDEEEEKEEAKSAEFEKPDPTK
NSCSRQ
Download sequence
Identical sequences ENSCPOP00000018762 ENSCPOP00000018762 10141.ENSCPOP00000018762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]