SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000019175 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000019175
Domain Number 1 Region: 184-335
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 6.12e-27
Family Retrovirus capsid protein, N-terminal core domain 0.0047
Further Details:      
 
Domain Number 2 Region: 341-420
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.13e-18
Family Retrovirus capsid protein C-terminal domain 0.0019
Further Details:      
 
Domain Number 3 Region: 1-88
Classification Level Classification E-value
Superfamily Retroviral matrix proteins 8.36e-17
Family Mason-Pfizer monkey virus matrix protein 0.00091
Further Details:      
 
Domain Number 4 Region: 436-491
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000779
Family Retrovirus zinc finger-like domains 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000019175
Sequence length 499
Comment (Cavia porcellus)
Sequence
MGQSFSSPFLKILKHLLSMYGISLRSADLDMCVHTIKEYNPWFPDEGTLDLELWRRARAN
IEKAMRQDEKISLCFSAIWSVVYSLLKAMEDEHIVENFQQEIKPVIQELPLTEEEQTIVQ
NDVIALTTEKAAKLKTVQCLTQAVEQLSIKQSLPICPSVPPPSNPDWKNAKLALADMPGT
GDSEDDETSVFAFPVITPQPADGEAWEGFNMDDLTKLKKAVTLYGPQAHYTRELLMAVAD
QYGNLAPYDWKTLAKILLKVPEYLQWHMWFMEGCAEKARQNAEDRDPNVRLISYPMLSGT
GFYDTVEHQAAAPREIHAQLRNIALEAWDKMRPQGSEYGSRAKVLQRSNEPYVEFISRLQ
NVIEKTVVGKDLQQHLLKLLAFENASDECKKVLIPIKDTGTIDNFIKQCKDLNSESKKMQ
LFAETMVTTWNNLQSKKEQSLKCFGCGQTGHVKRACPKLSDNDQGKKSKARCLCPKCHKG
HHWARECRSNSAEQKGNGK
Download sequence
Identical sequences ENSCPOP00000019175 ENSCPOP00000019175 10141.ENSCPOP00000019175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]