SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000019354 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000019354
Domain Number 1 Region: 325-362
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000995
Family Retrovirus zinc finger-like domains 0.0019
Further Details:      
 
Weak hits

Sequence:  10141.ENSCPOP00000019354
Domain Number - Region: 303-324
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0419
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000019354
Sequence length 377
Comment (Cavia porcellus)
Sequence
MATGGGAEEDRMRGRAQLLPQEAEGTREKMGWAQVVKNLAEKKGDFREPRPPRREKEGSS
GERGKRGSDDFPPAAAGTRRVGRRESGRRGGRLPQEKGAAEPNRRKKAEAAAIATPARTG
EAEDAGERPLPDEQAKGRFLVRICFQGDEGACPTRDFVVGALILRSIGMDPSDIYAVIQI
PGSREFDVSFRSAEKLALFLRVYEEKREQEDCWENFVVLGRSKSSLKTLFILFRNETVDV
EDIVTWLKRHCDVLAVPVKVTDRFGIWTGEYKCEIELRQGEGGVRHLPGAFFLGAERGYS
WYKGQPKTCFKCGSRTHMSGSCTQDRCFRCGEEGHLSPYCRKGIVCNLCGKRGHAFAQCP
KAVHNSVAAQLTGVAGH
Download sequence
Identical sequences ENSCPOP00000019354 10141.ENSCPOP00000019354 ENSCPOP00000019354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]