SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000019944 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000019944
Domain Number 1 Region: 334-366
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000374
Family Retrovirus zinc finger-like domains 0.0052
Further Details:      
 
Weak hits

Sequence:  10141.ENSCPOP00000019944
Domain Number - Region: 63-109
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000288
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000019944
Sequence length 378
Comment (Cavia porcellus)
Sequence
YRHKRVLKTKRRRGGRGGPDPGLQPQRSQATPTPGRSPPTPTVPMGLAGSGHKSPCVPNM
TERRRNELSEEINNLREKVMRQSAENSNLQNQVQKLSEENSTLREQVEPISEDEEDDIEL
QGAAAATVPAFPNCLEELPEKFDGNPDMLAAFMAQCQIFMEKSTRDFSVDRVRVCFVTSM
MTGRAARWASAKLERSHYLMHNYPAFMMEVKHVFEDPQRREAAKRKIRRLRQGLGSVIDY
SNAFQMIAQDLDWNEPALIDQYHEGLSRHIQEELCHVEVAKSLSALIGQCIHIERRLIRA
AAARKPRSPSRALVQAQHHQADPTEPVGGARMRLTQEEKERRRKLNLCLYCGNGGHYADN
CPAKASKSSPAGNSPAPL
Download sequence
Identical sequences ENSCPOP00000009579 10141.ENSCPOP00000019944 ENSCPOP00000019944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]