SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000020436 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000020436
Domain Number 1 Region: 441-714
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.03e-66
Family Ankyrin repeat 0.00012
Further Details:      
 
Domain Number 2 Region: 8-81
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 4.05e-22
Family Mib/herc2 domain 0.00081
Further Details:      
 
Domain Number 3 Region: 154-227
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 8.89e-22
Family Mib/herc2 domain 0.0012
Further Details:      
 
Domain Number 4 Region: 68-148
Classification Level Classification E-value
Superfamily RING/U-box 6.83e-21
Family ZZ domain 0.0075
Further Details:      
 
Domain Number 5 Region: 897-952
Classification Level Classification E-value
Superfamily RING/U-box 0.0000012
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Weak hits

Sequence:  10141.ENSCPOP00000020436
Domain Number - Region: 831-873
Classification Level Classification E-value
Superfamily RING/U-box 0.00273
Family RING finger domain, C3HC4 0.054
Further Details:      
 
Domain Number - Region: 361-388
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0732
Family NfeD domain-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000020436
Sequence length 957
Comment (Cavia porcellus)
Sequence
PTMDPDPQAGVQVGMRVVRGTDWKWGQQDGGEGGVGTVVELGRHGSPSTPDRTVVVQWDQ
GTRTNYRAGYQGAHDLLLYDNAQIGVRHPNIICDCCKKHGLRGMRWKCRVCFDYDLCTQC
YMHNKHDLAHAFERYETAHSRPVLLSPRQGLPRTPLRGIFQGAKVVRGPDWEWGAQDGGE
GKPGRVVDIRGWDVETGRSVASVTWADGTTNVYRVGHKGKVDLKCVGEAAGGFYYKEHLP
RLGKPAELQRRVSADGQPFQRGDKVKCLLDTDVLRDMQEGHGGWNPRMAEFVGQTGTVHR
ITDRGDVRVQFNHEIRWTFHPGALTKHNSFWVGDVVRVIDDLDAVKRLQAGHGEWTDDMA
PALGRVGKVVKVFGDGNLRVAVDGQWWTFSPSCLVAYRPEEDANLDVAERARENKSSLSV
ALDKLRAQKSDLEHPGRLVVEAALGNVTRAVELLRRHPEQVDTRNQGRTALQVATYLGQV
ELVRRLLQARAGMDLPDEEGNTALHYAALGNQPEAAKVLLSAGCGANALNGARSTALHVA
VQRGFLEVVQVLCECGCDVNLPDTHADTPLHSAISAGPGASGIVEVLTEVPGINITATNS
QGFTLLHHASLKGHTLAVRKILLRARQLVDAKKEDGFTALHLAALNNHQEVAQILIQEGR
CDVNARNRKLQSPLHLAVQQGHVGLVPLLVDAGCSVNTEDEEGDTALHVALQRHQLLPLV
ADRAGGDPGPLQLLSRLQALGLPGSTELTVGAAIACFLALEGADVSYSNHRGRSPLDLAT
EARVLKVLQGCAQRFRELQGGGGGLAVGPRLARSTPNTVTNLHVAAAGPEAAECLVCSEL
APLVLFSPCQHRMVCEECARRMKKCIRCQVAISKKLRPDGSEVAGATPAPGPPRQLVEEL
QSRYRQMEERITCPICIDSHIRLVFQCGHGACAPCGAALSACPICRQPIRDRIQIFV
Download sequence
Identical sequences 10141.ENSCPOP00000020436 ENSCPOP00000020436 ENSCPOP00000020436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]