SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000020783 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  10141.ENSCPOP00000020783
Domain Number - Region: 328-366
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00014
Family Retrovirus zinc finger-like domains 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000020783
Sequence length 401
Comment (Cavia porcellus)
Sequence
MASILACVSNSRRQNTSLPPWAHSMLRSLGRSLGPLMANIVERNMKLFSGRAVPAYGEET
FENWLIQVNGVLPDWNMSEEEKLKRLMKTLRGPAREVMRLLQAANPNLSVADFLRAMKLV
FGESESRVTAHGKFFNTLQAQGEKASLYVIRLEVQLQNAIQAGVLAEKDANQTRLHQLLV
GAELNRDLHFRLKHLLRIYANEQERLPNFLELIRMIREEEDWDDTFIKRKRPKRSESIME
RATSPVEFQSSLPMATDSVDCNVIEIDDTLDDSDEDVILVEPEDPPLSFSDALPLRDRAR
SQDQVLVIDSPNSAEGQFLSASGDFGYKNNGSGDMCRGKKRKHPMYCSYCGEEGHSKETC
DNESNKAQVFENLIITLQELTHTEEEEEGSREAPYALNDPF
Download sequence
Identical sequences ENSCPOP00000020783 ENSCPOP00000020783 10141.ENSCPOP00000020783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]