SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 101510.RHA1_ro01629 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  101510.RHA1_ro01629
Domain Number 1 Region: 718-923
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 5.36e-21
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.015
Further Details:      
 
Domain Number 2 Region: 26-202
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0000000000000942
Family Pyruvate oxidase and decarboxylase Pyr module 0.036
Further Details:      
 
Domain Number 3 Region: 433-617
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.00000000854
Family Pyruvate oxidase and decarboxylase PP module 0.074
Further Details:      
 
Weak hits

Sequence:  101510.RHA1_ro01629
Domain Number - Region: 277-356
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.000785
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 101510.RHA1_ro01629
Sequence length 1170
Comment (Rhodococcus jostii RHA1)
Sequence
MTQLDDARTSAASFDLADRYRADSGPVLMTGVQAIARQLVEQHERDRRAGLNVATFVSGY
QGSPLAGLDRTIAAIPTLSTDHDVKFVPGMNEELAATSVWGSQVDLPQGERTHDGVVGVW
YGKGPGLDRASDSIRHAAMYGANARGGVLVLVGDDPNAKSSTIPCASERSMAAMGMPVFF
PRNAEEVITFGLYGVALSRISGCWSGMKIVADVADGLWTLDRNFADLDIVLPEIEWNGKP
WSYRQRVLASPPDSVYAEADLYGPRWAMVEAFNAANEIDKIEVNPRSAWLGIAAVGTAYD
SLRQALLDLGLGDSQLEDAGIRILRVGMPYPLGADKVRELADGVEQVLVVEEKMPFVESQ
LKDILYGGASAPAVLGKKNAQGKNLIPVDGELTAARLTGPLRRVLKDRVALTPAPPPRLE
LTVLPTSRTPYFCSGCPHNRSTAVPEGSIAGGGIGCHTLVTMSGRTDSAVTMLTQMGGEG
AQWIGQAPFSDVKHMFQNVGDGTYFHSGQLAVQACVAAGVNITYKVLYNSAVAMTGAQDA
EAGLTVPQLTHKLASEGVKQIIVCAEDPKRHKGAHFAANTLLWDRTRLDEAQRVLRDIEG
VTVLIFDQQCAAEARRKRKRGKLPARRTRVVINEAVCEGCGDCGVKSNCLSVQPVDTEFG
RKTKIDQTSCNTDYSCLEGDCPSFVTVELPEEGAPKTLREIPVPPEVGDPDPAVWTGTHN
LFMAGVGGTGIVTVNQVLGMAALRAGLHVEGLDQTGLSQKAGPVTSHLRLSDQKTRSGSS
APSNRISPATADCVLAFDLLTAADAKYAGFGSSERTITVASTSQTPTGDMVYDPAVRYPD
EDKLLERLDVSARELTAIDGLAAATALFGSTAAANFLLVGAAYQAGGLPVPARFIEEALE
INGVAVESNKAAFHWGRVAVADREAFLAATSSAAVPQRSDTVVPTHLFAGSTLDGTTLEL
TERRAANLVAFQGDRVAARYIALVQQAWDAERELGSRTEFSEAVAAGLHKLTAYKDEYEV
ARMLTDQAFLDAAAGEVPGAGKLTYKLHPPVLKAMGRKTKIGFGPRSHVALKTLAKAKFL
RGTAFDPFGYAKVRRLERQLLAHYETTVTRLVADLSADTYDTATLIAATPDLVRGYEDVK
LRNVTVYLQRLAELGVDTSTITIATTPERS
Download sequence
Identical sequences Q0SG94
gi|111018628|ref|YP_701600.1| 101510.RHA1_ro01629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]