SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 101510.RHA1_ro02115 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  101510.RHA1_ro02115
Domain Number 1 Region: 3-97
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000051
Family Anti-sigma factor antagonist SpoIIaa 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 101510.RHA1_ro02115
Sequence length 102
Comment (Rhodococcus jostii RHA1)
Sequence
MLVGVRGEIDLFSAPGFRDYVCTRISPEGQFILDMSKVDFIGTAGLSVLDTVHATNVRDG
RTWAMICGRPVYRLLRAAGQESSYPCFASVDSALGAWHGRTA
Download sequence
Identical sequences Q0SEW4
gi|111019108|ref|YP_702080.1| 101510.RHA1_ro02115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]