SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 101510.RHA1_ro05787 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  101510.RHA1_ro05787
Domain Number 1 Region: 265-318
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000672
Family AraC type transcriptional activator 0.031
Further Details:      
 
Weak hits

Sequence:  101510.RHA1_ro05787
Domain Number - Region: 74-136
Classification Level Classification E-value
Superfamily Regulatory protein AraC 0.000111
Family Regulatory protein AraC 0.0075
Further Details:      
 
Domain Number - Region: 214-253
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0762
Family AraC type transcriptional activator 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 101510.RHA1_ro05787
Sequence length 329
Comment (Rhodococcus jostii RHA1)
Sequence
MVAASSVIRPAAQRLVSFDEFREAVSDAFVPLEMTSADHDDFRGVVRGVTVGAVRISEVT
AAPHVIRRTPRTIRAANPDYFKLGLQVRGNCVLSQDGRETALTPGDFAIYDTTRPYQLSF
DDRFRMLVVMFPRHLLRVPPDGVAQLTARRVPGGQGLGAVVTPLLRGLGEQIADASPTVA
VHLGDAVLDLVAAAFAEQLHLAGGVLPQSRGDALLARVTAFIDERLADRDLDLHSIAAAH
HISVRHLQKMFEADGDTVSGWIRRRRLEQCRRDLADPSYRDLPVSAIGARWGFADAAHFS
RLFKNAHGSTPGRYRADATPVTESTRPTR
Download sequence
Identical sequences Q0S4H2
101510.RHA1_ro05787 gi|111022750|ref|YP_705722.1| WP_011597896.1.78234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]