SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 101510.RHA1_ro07218 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  101510.RHA1_ro07218
Domain Number 1 Region: 76-137
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000798
Family NfeD domain-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 101510.RHA1_ro07218
Sequence length 140
Comment (Rhodococcus jostii RHA1)
Sequence
MIWLVAGVLLAAAEALTGDFFLLMLAGGALATAGVTAITDFPVWVDAVIFGVLSLALILG
VRPVLLRKFETPPPTPTGIEALTGKQALVLEEVAEHAGQIKLGGDVWTARPLDSTEVYPP
GTTVTVMQIDGATAVVWRGP
Download sequence
Identical sequences Q0S0F4
101510.RHA1_ro07218 gi|111024168|ref|YP_707140.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]