SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10228.JGI32543 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  10228.JGI32543
Domain Number - Region: 93-123
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00811
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI32543
Sequence length 563
Comment (Trichoplax adhaerens)
Sequence
MSLTAAAAETANNNNRVTRENWKKQKELEEARKAGTAPAEVDEEGRDINPHIPKYIKDVP
WYYGINRPSLKHQRIQGEIEQDSSPLNDWYRRGTQKVAAKKFRKGACENCGAVTHTKKEC
TERPRRIGAKFNEKNIKPDEFVQPKLQFDYDGKRDRWNGYNPDDYKQVIEEYAKIDMAKR
QMKAEKLSKELNADEENNQEKNVHDESDSDSDADSDKDEDKYAEQADMPGTKFDSKIRMT
VRNLRLREDTAKYLRNLDPNSAFYDPKTRSMRDNPYKQTGDNPEDLPYAGDNFIRHSGDT
VAMAKSQLFAWEAYNKGVDVHVLAEPTKLELLRKEFNVRKDDFQDNKQKRILEKYGGEEH
LDAPPRDMLLSQTENYVEYSRFGNMIKGQEKVTIRSKYEEDILINNHKTVWGSYWKDGRW
GYACCHSFIKMSYCTGSLNQQSRLEAVNEMLELPTEAEQPKSLVEIHQENMKTKKIKRKT
SEADDADNTLKKKEKLASAIEAEIKNQQNAEKMLSLDERRRPYNPMEISVHEPTEEEMEA
YRLMKSRSDDPMAKYLEKNKKVK
Download sequence
Identical sequences B3SB74
XP_002117498.1.101920 10228.JGI32543 jgi|Triad1|32543|e_gw1.24.116.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]