SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI37016 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI37016
Domain Number 1 Region: 2-172
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.93e-61
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.000000185
Further Details:      
 
Domain Number 2 Region: 181-317
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 4.06e-40
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.00000873
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI37016
Sequence length 319
Comment (Trichoplax adhaerens)
Sequence
MSEEIERDEKVFMLGEEVGQYDGAYKVSKDMLRRFGEDRIIDTPITEAGFAGIAVGAAMA
GLKPICEFMTFNFSMQAIDHVINSAAKTFYMSAGKVNVPIVFRGPNGAAAGVAAQHSQCF
AAWYGHVPGLKVLSPYSSEDAKGLLKSAIRDPNPVVVLENEILYGSSFEMTEEAMSTDFL
VPIGKAKIERQGNDVTLVAHSRMVQICLEAAQELESKFNVSAEVINLRSIRPLDIDTIAS
SVMKTNHLIPVESGWPMFGVGSEIAAQVMESQAFNFLDSPILRVTGADVPMPYAKTLELH
ATPQSNNIINAVKKSLNIR
Download sequence
Identical sequences B3RI95
XP_002108914.1.101920 jgi|Triad1|37016|estExt_Genewise1Plus.C_11551 10228.JGI37016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]