SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI37229 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI37229
Domain Number 1 Region: 167-246
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.08e-24
Family Translational machinery components 0.0036
Further Details:      
 
Domain Number 2 Region: 85-156
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.26e-20
Family Ribosomal S5 protein, N-terminal domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI37229
Sequence length 277
Comment (Trichoplax adhaerens)
Sequence
MADAAPAGERGGFGEGFGRGRGRGGGRGRGRGRGRGRGRGRGKGDEKEWVPVTKLGRLVK
GGKIKRLEDIYLFSLPIKEAEIIDFFLGSKLKDEVLKIMPVQKQTRAGQRTRFKAFVAMG
DYDGHVGLGVKCSKEVATSIRGAITLAKLSIVPVRRGYWGNKIGLPHTVPCKVTGKCGSV
SMRLIPAPRGTGIVSAPVPKKLLQMAGVEDCYTSSTGQTRTLGNFAKATYSAIGKTYSYL
TPDLWEPTKFSMTPYQEFTDFLSNKQIRTERPRPRAY
Download sequence
Identical sequences B3RPU7
XP_002110080.1.101920 10228.JGI37229 jgi|Triad1|37229|estExt_Genewise1Plus.C_21017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]