SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10228.JGI37880 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI37880
Domain Number 1 Region: 146-435
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.83e-129
Family Enolase 0.00000000282
Further Details:      
 
Domain Number 2 Region: 7-144
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 5.3e-58
Family Enolase N-terminal domain-like 0.00000149
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI37880
Sequence length 436
Comment (Trichoplax adhaerens)
Sequence
MSDNAAILGVHAREILDSRGNPTVEVEVKTAAGVFRAAVPSGASTGIYEALELRDKEPSR
FLGKGVLKAVSNVNDVIGPALIKAGVAVTKQKELDQLMLQLDGTENKSKLGANAILGVSL
AVCKAGAAHKGVPLYRHIADLAGNEKIIMPVPAFNVINGGKHAGNLLPMQEFMILPTGAS
RFSEAMRMGCEVYHNLKSIIKAKYGQDATNVGDEGGFAPNFADGGEALQLLQEAIKKAGY
TGKISIAMDVAASEFCENGKYNLDFKKSNASPDNLLAGSELVKLYQSYVSNYPIVSIEDG
FDQDDWESWSALTAAVDIQIVGDDLTVTNPKRIKTAIERKACNCLLLKVNQIGSVTESID
ACKLAQQNGWGVMVSHRSGETEDTFIADLVVGLRTGQIKTGAPCRSERLCKYNQLLRIEE
ELGDNAVFAGANFRNP
Download sequence
Identical sequences B3RZY5
10228.JGI37880 XP_002113820.1.101920 jgi|Triad1|37880|estExt_Genewise1Plus.C_60985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]