SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI52767 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI52767
Domain Number 1 Region: 99-198
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000607
Family Tetratricopeptide repeat (TPR) 0.017
Further Details:      
 
Domain Number 2 Region: 14-127
Classification Level Classification E-value
Superfamily TPR-like 0.00000032
Family Tetratricopeptide repeat (TPR) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI52767
Sequence length 203
Comment (Trichoplax adhaerens)
Sequence
MATRYSELKIFQKIQLLYEEGEKKYIAQDDLNAISNYEQALDQIQSLPKKDTDLELQYKI
NLRITDIYIRHGEWSQATKFRQHALYMANRMKNQVYIADCIDRQGDIKRMTGDESGALSD
FRISLDMKLKSLDGDNLSIGDTYHKIGRAYFSQKEYNRALLMYQKALDIRIRKLGDDDLI
VAQSYHNIGLAYSNLGMLEMLSI
Download sequence
Identical sequences B3RK99
10228.JGI52767 jgi|Triad1|52767|fgeneshTA2_pg.C_scaffold_1001514 XP_002108367.1.101920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]