SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI53086 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI53086
Domain Number 1 Region: 11-160
Classification Level Classification E-value
Superfamily UBC-like 4.66e-49
Family UBC-related 0.00000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI53086
Sequence length 202
Comment (Trichoplax adhaerens)
Sequence
MAANLLGQALPSEIVKRVIRELGNLMSDPPEGIKIFPNDGDVTTLYAAIEGPVGTPYEGG
IFRLKLMLGKDFPMVPPQGYFLTKIFHPNVAQNGAICVNTLKKDWKPDYGIQHILLTIKC
LLIVPNPESALNEEAGRLLLERYIDYSHRAMMMTEIHAMDYKKNSLSENVDPAKGEIATK
RYFEEKKVERKTKDKKRALKRL
Download sequence
Identical sequences B3RN95
10228.JGI53086 jgi|Triad1|53086|fgeneshTA2_pg.C_scaffold_2000243 XP_002109248.1.101920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]