SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10228.JGI53642 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI53642
Domain Number 1 Region: 64-87
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000017
Family CCCH zinc finger 0.0045
Further Details:      
 
Domain Number 2 Region: 179-207
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000209
Family Retrovirus zinc finger-like domains 0.0052
Further Details:      
 
Weak hits

Sequence:  10228.JGI53642
Domain Number - Region: 38-60
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00017
Family CCCH zinc finger 0.0072
Further Details:      
 
Domain Number - Region: 146-171
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00113
Family CCCH zinc finger 0.0049
Further Details:      
 
Domain Number - Region: 119-142
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00327
Family CCCH zinc finger 0.0066
Further Details:      
 
Domain Number - Region: 90-118
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0275
Family CCCH zinc finger 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI53642
Sequence length 257
Comment (Trichoplax adhaerens)
Sequence
MESIIANVDNIKFTIEFELDDQIGTQQLPFPGMDKSGAAVCTYFAESQCVKGSMCPFRHT
KGDKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECQYLHINPESK
IKDCPWYDRGFCKHGPACRHRHVRRVACLNYLNGFCPEGSNCKHVHLRFELPTREIDIHS
ESKRKPSVVVCHNCGEYGHKASACPNQLISIQKENSLTNDNGNSIGISHDQNQQQQKRPM
DQVICFKDSSSLRFIYR
Download sequence
Identical sequences B3RPS1
XP_002109523.1.101920 jgi|Triad1|53642|fgeneshTA2_pg.C_scaffold_2000799 10228.JGI53642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]