SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10228.JGI53818 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI53818
Domain Number 1 Region: 224-387
Classification Level Classification E-value
Superfamily E set domains 1.91e-17
Family Cytoplasmic domain of inward rectifier potassium channel 0.0025
Further Details:      
 
Weak hits

Sequence:  10228.JGI53818
Domain Number - Region: 135-244
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0051
Family Voltage-gated potassium channels 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI53818
Sequence length 420
Comment (Trichoplax adhaerens)
Sequence
MAFQNAQDIKNAAIQERRHSWPHQPRMMYPNFSSKNSSRFNSLSYLRRLFRRISRVIADT
LMQPNLLCMTVNAIPWMIQSLYRWIKKCIIFLSLYLWDCVCLNYIRASERADLDGTSAMD
DSLANRLKNVHFQNYQIRLDYDLYGNIVRMPWSYIFSLFAMIYLVTSIIFTFAYVCADLI
DFELGYSCWHWLVFSLSTTTCLGSDSLDPDQAHLLLVLLANLQAFISQLLLASVTGIVFA
RFSRRRRQIQFADKLIINRINGVSYLQGRFTPIRPRYGVFNCIIQLYLTRSYHTEEGENG
FSVHALPLACDTFPIVAMAVKFSHQLDDSSLLRQTLTNSSKDFGLIVCVMGADACNMNPV
FDLIRYRREHIVKNARFANMVENIYSKDNKKDVYIFCDKLSQVILLKDYETEESSEGKEI
Download sequence
Identical sequences B3RQ90
10228.JGI53818 XP_002109617.1.101920 jgi|Triad1|53818|fgeneshTA2_pg.C_scaffold_2000975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]