SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10228.JGI54065 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  10228.JGI54065
Domain Number - Region: 114-142
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000879
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI54065
Sequence length 412
Comment (Trichoplax adhaerens)
Sequence
MPASHGFAKFMNNKDFHPGSQRNIKMVWMAEQRIAAKEKKEKELKEQYEKEQSLYKTREI
ISKDKEKLSVNFMYDAPPGLDKETKTTVKIFLCRNDAYRIHYAKDIAATDKPFGIAVRNV
RCIKCGKWGHVNTDRECPLFNHTISVSAPSDQNEEASDEISPEKLMQAMRENGLTLKQSV
LGRVVDNRAANQQMIESEEELIDDPEVNFLNSLTRKQKKKLLKKLDKLDKKAEGKSSEKK
KKKKKKSKKSSSSSDEDSDRHYRSTQKKNKKSKANNLSGDSSSSDEETTKKSKASSAYRK
DMRDDPIMLAEHRSKGTDSHRYRSRSRSPESERRKYSEQHRTSKTEKPHRSRRSRSRSRS
TERFHDRSRGRSDYRNVDTSESRESRYNTHHRYRSSDKKSSGHHREHESKHY
Download sequence
Identical sequences B3RR05
jgi|Triad1|54065|fgeneshTA2_pg.C_scaffold_3000072 10228.JGI54065 XP_002110255.1.101920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]