SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10228.JGI55418 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI55418
Domain Number 1 Region: 277-314
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000044
Family Retrovirus zinc finger-like domains 0.002
Further Details:      
 
Domain Number 2 Region: 8-59
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000756
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 
Domain Number 3 Region: 61-108
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000442
Family Retrovirus zinc finger-like domains 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI55418
Sequence length 319
Comment (Trichoplax adhaerens)
Sequence
MIGAQYYNLRDCRCFLCGNVGHVSAYCPFEDDLFNKIASAPACYKCGLTNHSSINCPNYT
EDRRCYKCHKVGHLASHCTEPRRNTYLQDGQYYSCNGASHLGEKCKDQKGDTYLQNCKNR
NVTITSKSLMEKLSPQHEKNEEVTPQTGNNLETIYKKIDDNAQTNKSEELLREENLHKRP
RLEREVHDKLQTDRMYNNNLYTHADESTCFKPILIAEDTLLSHKPVTEQVLDKPMTHGKA
INNRNNGLNYENLQGTKAGINKLTRITESSISKKVDEDVQCYRCKGRGHYARDCRNIVCY
RCGSRGHYAYTCKSLVFKK
Download sequence
Identical sequences B3RUU6
jgi|Triad1|55418|fgeneshTA2_pg.C_scaffold_4000309 XP_002111919.1.101920 10228.JGI55418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]