SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10228.JGI56340 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI56340
Domain Number 1 Region: 1572-1670
Classification Level Classification E-value
Superfamily Bromodomain 3.14e-28
Family Bromodomain 0.00014
Further Details:      
 
Domain Number 2 Region: 1480-1549
Classification Level Classification E-value
Superfamily Bromodomain 0.0000000000955
Family Bromodomain 0.00072
Further Details:      
 
Domain Number 3 Region: 5-52
Classification Level Classification E-value
Superfamily TAF(II)230 TBP-binding fragment 0.0000017
Family TAF(II)230 TBP-binding fragment 0.0051
Further Details:      
 
Weak hits

Sequence:  10228.JGI56340
Domain Number - Region: 1337-1370
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00984
Family Retrovirus zinc finger-like domains 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI56340
Sequence length 1794
Comment (Trichoplax adhaerens)
Sequence
MSSILANLMFGNIDEDGELEDDSLLDKESKRQLSQITCEFGLDTIVDDFNDDEVQDEDYR
TSGNVPTSRSAVDFIDIQELAEDNNDHGNCESTLSALIAGKSSPNNGNNENKNLLNTMGS
NSLFSNDGSFATSPTDSEYTKDGIKVADDHQALESEDSESQDDVDWNQIIETYDQSELSN
NKELLLKNLAKCKAGFPAVMFGMSNDKDGIVRTRTGSTVIDLFPEFKPGEVLRFTRLFGP
ARAASMPQVWRNARRTRKRRRQEVINEGFGHRSHCSRSLPHAPSNRVAEDDEVLFLSSLK
RKFNASSIIHNTEVDNVDERNKKSKKRPKWRFGPARYWYDQKGLPEDGSIPEYKSNRKEA
YNPEKRSHGRKLDISAYTMLAQQEWENNIIWSADDVRQKRNSADAERVEAEAGWIPSTRC
RTFLNHLGDKRMKTSESMFPIQNRELVYTRWEDNIIWDTPTYPSISTNPELRLDPNDENI
LCIPYVPDKGPVSKATQDKETKKEKGKGKTALSKSGASKIDNMELPEEMKVKDIDKDSYN
FSNDAYYSTKTNTTGGGVSNTLGVRAVLHSTPSVQLNPKLFPTHWTPYSLRNFHRPIFCR
PNYGKHHKAPFMIRSVTKRIRKKAKERERARAASGGGEIFFMVNLEDLSATDGEVMLLEY
SEEHPPLIQAVGMASRVKNYYRKKASKDTGPQSPEIGEMVMVNNNSPFLGSLSHGQLLQA
FENNLYRTPIYKHKMPDDLFLVIKNHNGYHIREAKWLHTGGQLCPKFEVPSPNSKKASNF
VRDFLQVYIYRLFAKSTDNPKRIKMDAIKKSFTSHSESSIRKRLKLCADFKRTGDHSNYW
ILKPDFRLPSEEELRDMVTPEQACAYACMLAAEQKLKDAGYVGKTVVEDEDNEDSQKIED
EVKTAPWNTTRAFLQALQGKCQLSLTGDADPTGCGEGFAYVRVPNKPVVPKDESNVINKQ
RTVTGTDADLRKLSLKNARQVLRDFGISDEEIKKLSRWEVIDVVRTMSTAAVKSGEDGLS
KFARGSRFSLAEHQERYREECQRIFEIQNKVLASEEVLSTDEESVSEGDDEFDELGKNLE
SMLMNKKSAAEYSNEREEAERLELKKMLSEDDVRIHKSGSKSQYSEMIFTNPIVYSLSHF
IGSVFSYPRFLVCSISELCHSIRHNYRNFFKNFFLLILDKDEDDKASVISETSSMRSEQT
QDRVPGSRLIIHRTFSQDGREFVRNEVVTDPEVIDAYIRIATNKKGNIRSEFATFDREHR
EDIRKEKKRIQEKLRRLERAEKKAKEIQNKKEEKLQPVTITAQPPQIENDTAPELSTLKK
DQSKQNVQSESQTKKKKEKPPVAVNLRCGACGEKGHMKTNKNCPKYNETMGPSEHVIAMT
EEQIKEEEDKIAEENFVKVEGTKLLIGKALLHQTRIKTCLCLYSHDEVRRRSLVLRFPKA
YFKRRRVSRSSSNANLDYLKGPTKSKNRRRTAPEVTLANIFEEIVIKMRNVKNNIRERNY
NSREEFLEHCSLLVTNSVHYNGGDSPFTKTAQEMFSVCTDELEKKDKEISQLERELNPLL
DDDPEVGISWLFEHTVMQMKSVPDSFAFHGPVDVVTVPDYYTIIKDPIDLGVIQRKAQNH
EYRSHSDFMKDIDLLFANCVIYNGENEYTKIARMMVATCNETLDEFSAQIQQLERELAGV
SSENDKIDNLLDSSDIVIGETEKFHHSSGIGKEIIERDEEEMDVDLSDLKDGEDKGIIFV
VEGQDSEPGEVDIMNIKPDQEPFKNDQSGNVMLSPDNILDNDLNLSSSDDDYSD
Download sequence
Identical sequences B3RXV1
jgi|Triad1|56340|fgeneshTA2_pg.C_scaffold_5000234 10228.JGI56340 XP_002112811.1.101920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]