SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10228.JGI57508 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI57508
Domain Number 1 Region: 53-81
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000164
Family Retrovirus zinc finger-like domains 0.0063
Further Details:      
 
Weak hits

Sequence:  10228.JGI57508
Domain Number - Region: 95-128
Classification Level Classification E-value
Superfamily RNA polymerase subunits 0.0314
Family RBP12 subunit of RNA polymerase II 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI57508
Sequence length 172
Comment (Trichoplax adhaerens)
Sequence
MYPVVGNSPLFLAPAECLNSVVDPHLQMDQAQRDSLPFVSDGNLWQNRQIRRAVPPEYLC
HLCFQKGHLINDCPWAPPKSKGLTPYQGTKRCFGEYACANCKRKWMSGNSWSNAGQTCKI
CGERVYPHRQKPLDRSAYSGSEFCPRKEHPRHLCEMCMQLGDYCRKNKSIGQ
Download sequence
Identical sequences B3RZM4
10228.JGI57508 jgi|Triad1|57508|fgeneshTA2_pg.C_scaffold_6000488 XP_002113390.1.101920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]