SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10228.JGI57804 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI57804
Domain Number 1 Region: 443-599
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 2.99e-33
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.047
Further Details:      
 
Domain Number 2 Region: 604-738
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.23e-30
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.0083
Further Details:      
 
Domain Number 3 Region: 224-385
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 4.71e-30
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.01
Further Details:      
 
Domain Number 4 Region: 775-808
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000837
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI57804
Sequence length 1063
Comment (Trichoplax adhaerens)
Sequence
METKVEDIENVPTNVVESSGRSDMVHSIKLHDQMVLVKVISKDQFPDATWVDLRLLENHK
LASIVDTKMNDQEDEDGKQSTDQSQRQLVCLRCEQVLENCTLSAFQTHCWNKIKALRNGY
LQNEIRWFVKHISDEHYRKLDIFTEVTAEQSGLSAFSLKQRAKIVTELQEIVTEFCDRDS
LIVEIKKILEDNAVLIVDVEIWLLFIKSTMQDTLIATYCKIDSRTRQLGVVLRKWARVCG
IDRPNEGGLHPGALIIMLIYYLQRCTPPVLPVLHELASDDQSKNFNYEIDGVPFIYFNDI
DTLDDIWQSDNEKSIGQLWLGFFTFYSLDYGISRNVVCITSKSTITRRMRKWEANSFAIE
SPFGNRHNCGKTVTTRQVIECPKQFEWLSDSSKITDTFQLEKIFVSGTHEMPLRCPSCDG
NHRKDNCPESISTLNPLPEMNIDYLRAIDEFCYYVKDYYAMSAEEKQFREEILHRVTKAM
QAIFPEATLHLFGSSKNGFGTKQSDVDMCMMIPDDSLNCLDEKLRGQEAIRRIAKQLRKK
SRDFAKVQDISRATVPIVKFYDVRRYVNPTCSLNRKLSCDISYQNALAVHNTNLLASYGS
LDDRIPILVLVLKLIAKACDIGDASRGSLSSYAHTLMMIYFLQHCDPPVLPVLQELHDGD
KPEQTVENWNVWFQEDRETIRKWSGFGKNKESVGSLLLKFYRYYTETFNFTTDVIAIRQF
DPMTKLNKGWYTKFIAIEVNSYIKSVLRNCRTIFGTPQPIQHHFMDHFLNLSKLTNGKKS
PDQNRCFNCGFIGHRRKDCPKSRNFREQTQGLPAHRDNSPKMLAQAFNVLKINENGKPKQ
GDAKFSQANSLWQQQNVQTGPVAMPNVQWQHNPKIPVYMEMPILLNNGGVMNTISKMPYY
PYAPFNMHQHTLNANNAYQLNPYSNFKNYHVVSPTNVSSNETTVNDNMSDYECKSSIPEK
LEAHGSVESYTETELDSKPSTSNQQNQSIQKESNSRGQQQYDEHKHRRYPPIFHHTTHEM
PPNDVENLSTIKKSTDLTWQQGRLIDEIGRSRKKNRIRKPKAN
Download sequence
Identical sequences B3S1E8
jgi|Triad1|57804|fgeneshTA2_pg.C_scaffold_7000022 10228.JGI57804 XP_002113905.1.101920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]